PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 286aa    MW: 32349.6 Da    PI: 7.5492
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0169genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-162976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed++l+ +++ +G g W+  +++ g++R++k+c++rw++yl
      Gh_D07G0169 29 KGAWTDWEDKILASYINVHGEGKWRNLPKRAGLKRCGKSCRLRWLNYL 76
                     79********************************************97 PP

2Myb_DNA-binding50.83.9e-1682126147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
      Gh_D07G0169  82 RGNISHDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 126
                      78999*****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-222079IPR009057Homeodomain-like
PROSITE profilePS5129414.9892476IPR017930Myb domain
SuperFamilySSF466897.65E-2726123IPR009057Homeodomain-like
SMARTSM007173.1E-122878IPR001005SANT/Myb domain
PfamPF002496.7E-152976IPR001005SANT/Myb domain
CDDcd001677.06E-93176No hitNo description
PROSITE profilePS5129424.1777131IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2380130IPR009057Homeodomain-like
SMARTSM007176.5E-1581129IPR001005SANT/Myb domain
PfamPF002492.6E-1482126IPR001005SANT/Myb domain
CDDcd001671.84E-1086127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MDLYKQRERV GEIRSMGKSS CCSKEGLKKG AWTDWEDKIL ASYINVHGEG KWRNLPKRAG  60
LKRCGKSCRL RWLNYLRPDI KRGNISHDEE ELIIRLHNLL GNRWSLIAGR LPGRTDNEIK  120
NYWNTTLGKR AKAQASIDAK TIPTESRLNE PSKSSTKIEV IRTKAIRCSS KVMVPLQPPA  180
THQHGQHHCT NNNEEMGGGI STIEAHNGIQ MLESLYSDGG SNLLSFEINE LLKSHDGGEF  240
EENPMQQHFP LGEAMLKDWS TCHCLDDNGA TDLESLAFLL DTDEWP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-222713125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461890.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362840.0AF336284.1 Gossypium hirsutum GHMYB36 (ghmyb36) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488054.10.0PREDICTED: transcription repressor MYB6-like
SwissprotQ9FJA22e-63TT2_ARATH; Transcription factor TT2
TrEMBLQ9ATD30.0Q9ATD3_G
STRINGPOPTR_0006s23840.12e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-64MYB family protein